PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G14810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 372aa    MW: 39342.3 Da    PI: 9.5763
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G14810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.53.5e-55251521128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL +kv + +++  ++i+e+d++k+ePw+Lp+k+k +ekewyf+s rd+ky+tg r+nrat +gyWkatgkd+e+ s
  OGLUM06G14810.1  25 LPPGFRFHPTDEELITYYLLRKVVDGSFNG-RAIAEIDLNKCEPWELPEKAKMGEKEWYFYSLRDRKYPTGLRTNRATGAGYWKATGKDREIRS 117
                      79*************************999.89***************99999****************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +g+lvg+kktLvfy+grapkg+kt+Wvmheyrl
  OGLUM06G14810.1 118 ArTGALVGMKKTLVFYRGRAPKGQKTQWVMHEYRL 152
                      868889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6124177IPR003441NAC domain
PROSITE profilePS5100559.81925177IPR003441NAC domain
PfamPF023655.2E-2826152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MERCSVLGLG GGGGGGGGGR LDGELPPGFR FHPTDEELIT YYLLRKVVDG SFNGRAIAEI  60
DLNKCEPWEL PEKAKMGEKE WYFYSLRDRK YPTGLRTNRA TGAGYWKATG KDREIRSART  120
GALVGMKKTL VFYRGRAPKG QKTQWVMHEY RLDGTYAYHF LSSSTRDEWV IARIFTKPGV  180
FPVVRKGRLG ISGGGGDTSC FSDSTSASVG GGGGTSASSA LRAPLAEASL FAAAAAPAQL  240
RRGXXXXXGG GSATATANLV TGLELVPCFS TTAHMDASFG TGQYNPAPLA VEPPPPPPAF  300
FPSLRSLQEN LQLPLFLSGG MQAGVSSQPL SGGGAFHWQS GMDVKVEGAV GRAPPQMAVG  360
PGQLDGAFAW GF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-532517717165NO APICAL MERISTEM PROTEIN
1ut4_B1e-532517717165NO APICAL MERISTEM PROTEIN
1ut7_A1e-532517717165NO APICAL MERISTEM PROTEIN
1ut7_B1e-532517717165NO APICAL MERISTEM PROTEIN
3swm_A2e-532517720168NAC domain-containing protein 19
3swm_B2e-532517720168NAC domain-containing protein 19
3swm_C2e-532517720168NAC domain-containing protein 19
3swm_D2e-532517720168NAC domain-containing protein 19
3swp_A2e-532517720168NAC domain-containing protein 19
3swp_B2e-532517720168NAC domain-containing protein 19
3swp_C2e-532517720168NAC domain-containing protein 19
3swp_D2e-532517720168NAC domain-containing protein 19
4dul_A1e-532517717165NAC domain-containing protein 19
4dul_B1e-532517717165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0046790.0AP004679.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0021N09.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642575.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
SwissprotO040177e-93NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A0E0A9890.0A0A0E0A989_9ORYZ; Uncharacterized protein
STRINGBGIOSGA022861-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99403543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.15e-92NAC family protein